LC-MS/MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-06-10. Numbers and descriptions here follow the published literature rather than marketing material.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
GW501516 acts on PPARδ, a nuclear receptor that helps regulate fatty acid oxidation and energy homeostasis. In animal studies, activation of this receptor was associated with increased endurance and changes in lipid metabolism. Human trials examined effects on blood lipids and other metabolic markers, but the compound did not advance to approval. Rodent studies later reported tumors in multiple tissues at doses used in those experiments. Whether those findings translate to human risk remains uncertain, and the clinical relevance of the animal data is still debated.
Regulatory bodies treat GW501516 as a prohibited substance in competitive sport. The World Anti-Doping Agency added it to the prohibited list, and it falls under classes covering metabolic modulators and hormone-related agents. It is not approved by drug regulators for human use, and it is not a lawful dietary supplement. Products sold under the cardarine name may contain unlisted ingredients or different compounds. Because no approved product exists, quality and identity are not guaranteed by pharmaceutical manufacturing standards.
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
| Property | Value | Notes |
|---|---|---|
| Common name | Cardarine | Common internet and media name. |
| Research code | GW501516 | Also written GW-1516. |
| Drug class | PPARδ agonist | Not a selective androgen receptor modulator. |
| Development status | Discontinued | Clinical development halted after rodent cancer findings. |
| Regulatory status | Prohibited in sport | Listed by WADA; not approved as medicine. |
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
TRV250 is a δ-opioid receptor (DOR) agonist which is under development for the treatment of migraine. It is taken orally. The drug shows high selectivity for the DOR over the μ- and κ-opioid receptors. It is a biased agonist of the DOR, with preference for activation of G protein signaling over β-arrestin2 signaling. TRV250 produces analgesic, antimigraine-like, antidepressant-like, and anxiolytic-like effects in rodents. In addition, it has dramatically reduced proconvulsant activity relative to non-biased DOR agonists in rodents and monkeys, with a 50- to 80-fold margin between analgesia and seizures. TRV250 is being developed by Trevena. As of April 2025, the drug is in phase 2 clinical trials for treatment of migraine. No recent development has been reported for treatment of CNS disorders, while development for treatment of neuropathic pain and Parkinson's disease was discontinued. TRV250 was first described in the scientific literature in 2015.
== Regulations for pet food ingredients == Aside from the CFIA, which makes the use of specified risk materials illegal, pet food ingredients do not need to be approved by any regulatory body in Canada. However, if manufacturers plan to expand into the U.S. market, they must adhere to regulations imposed by each state, or comply with guidelines established by the American Association of Feed Control Officials (AAFCO). These guidelines will provide country-wide acceptable ingredients, and nutritional recommendations based on research collected by the National Research Council (NRC). As of August 2021, AAFCO has approved the use of Black Soldier Fly (BSF) insects in pet food - specifically for adult dogs. The use of insects in feed in the European Union was previously prohibited under an act called "TSE Regulation" (Article 7 and Annex IV of Regulation 999/2001) that bans the use of animal protein in animal feed. In July 2017 this regulation was revised and partially lifts the ban on animal proteins, allowing insects to be included in fish feed. This was coupled with another change that reclassified insects in the European Union (EU) catalogue of feed materials. This change specifically refers to fats and proteins from insects instead of classifying them under a broad title of animal products. Due to this change, producers now must list the species and life stage of the insect on their product. Novel pet food ingredients in Europe must also follow certain stringent regulations, making approval of new ingredients a lengthy process.
=== 2000s–present === In 2004, after 44 years as a privately held company, Domino's began trading common stock on the New York Stock Exchange under the ticker symbol "DPZ". Industry trade publication Pizza Today magazine named Domino's Pizza "Chain of the Year" in 2003, 2010, and 2011. In a simultaneous celebration in January 2006, Domino's opened its 5,000th American store in Huntley, Illinois, and its 3,000th international store in Panama City, Panama, making 8,000 total stores for the system. In August 2006, the Domino's location in Tallaght, Dublin, Ireland, became the first store in Domino's history to hit a turnover of $3 million (€2.35 million) per year. As of September 2006, Domino's has 8,200-plus stores worldwide, which totaled $1.4 billion in gross income.
Sources: en.wikipedia.org
=== 23 May === In its evening report, the Ukrainian military reported that there were 25 air strikes and 20 incidents of shelling reported across the country for the day, but no missile attacks. Yevgeny Prigozhin, head of the Wagner Group, promised to transfer control of the Ukrainian city of Bakhmut to the Russian army by 1 June. In an interview, he said that more than 20,000 of his fighters died in the battle for the city, and acknowledged that the Russian military had killed civilians. President Zelenskyy visited naval infantry troops along the Vuhledar-Maryinka defence line in Donetsk Oblast as part of commemorations of the Day of the Ukrainian Marines. He announced that new marine brigades would be added to the Ukrainian military's existing units. The governor of Donetsk Oblast said Russian aerial bombs struck Toretsk, damaging a school but causing no casualties. The Russian Ministry of Defence said that it had forced back "nationalists" who had launched the cross-border attacks in Belgorod Oblast back into Ukraine, adding that its forces had killed more than 70 "Ukrainian terrorists" and destroyed four armored combat vehicles and five pickups. The Governor of Russia's Kursk Oblast said three villages bordering Ukraine were left without power after a drone dropped explosives on an electrical substation. Ukraine accused Russia of blocking access to the port of Pivdennyi to grain exports despite the resumption of the Black Sea Grain Initiative.
During embryonic development, migratory neural crest cells are generated by EMT involving the epithelial cells of the neuroectoderm. As a result, these cells dissociate from neural folds, gain motility, and disseminate to various parts of the embryo, where they differentiate to many other cell types. Also, craniofacial crest mesenchyme that forms the connective tissue forming the head and face, is formed by neural tube epithelium by EMT. EMT takes place during the construction of the vertebral column out of the extracellular matrix, which is to be synthesized by fibroblasts and osteoblasts that encircle the neural tube. The major source of these cells are sclerotome and somite mesenchyme as well as primitive streak. Mesenchymal morphology allows the cells to travel to specific targets in the embryo, where they differentiate and/or induce differentiation of other cells. During wound healing, keratinocytes at the border of the wound undergo EMT and undergo re-epithelialization or MET when the wound is closed. Snail2 expression at the migratory front influences this state, as its overexpression accelerates wound healing. Similarly, in each menstrual cycle, the ovarian surface epithelium undergoes EMT during post-ovulatory wound healing.
As of 2009, 8 Prizes have been awarded for contributions in the field of signal transduction by G proteins and second messengers, 13 have been awarded for contributions in the field of neurobiology and 13 have been awarded for contributions in intermediary metabolism. In 1939 Gerhard Domagk, a German, was not allowed by his government to accept the prize. He later received a medal and diploma, but not the money. As of 2024, the prize has been awarded to 229 individuals, thirteen of them were women (Gerty Cori being the first to be awarded in 1947). There have been nine years in which the Nobel Prize in Physiology or Medicine was not awarded (1915–1918, 1921, 1925, 1940–1942). There were also five years for which the Nobel Prize in Physiology or Medicine was delayed for one year. The Prize was not awarded in 1914, as the Nobel Committee for Physiology or Medicine decided that none of that year's nominations met the necessary criteria, but was awarded to Robert Bárány in 1915 and counted as the 1914 prize. This precedent was followed for the 1922 prize awarded to Archibald Hill and Otto Fritz Meyerhof in 1923, the 1926 prize awarded to Johannes Fibiger in 1927, the 1938 prize awarded to Corneille Heymans in 1939, and the 1943 prize awarded to Henrik Dam and Edward Adelbert Doisy in 1944.
Sources: en.wikipedia.org
Specifically, some studies show evidence of components of the glyoxylate cycle existing in significant amounts in the liver tissue of chickens. Data such as these support the idea that the cycle could theoretically occur in even the most complex vertebrates. There is strong evidence of the cycle's presence in certain nematode species. Other experiments, later refuted, suggested the cycle was present among certain insect and marine invertebrate species. Some publications conflict on the presence of the cycle in mammals: for example, one paper has stated that the glyoxylate cycle is active in hibernating bears, but this report was disputed in a later paper. Evidence exists for malate synthase activity in humans due to a dual functional malate/B-methylmalate synthase of mitochondrial origin called CLYBL expressed in brown fat and kidney. Vitamin D may regulate this pathway in vertebrates.
== See also == Upper Voltan Territorial Assembly election, 1957 List of French possessions and colonies French colonial empire French West Africa Heads of state of Burkina Faso Heads of government of Burkina Faso
In 1966, E. O. Wilson and his colleagues identified the fossil remains of an ant (Sphecomyrma) that lived in the Cretaceous period. The specimen, trapped in amber dating back to around 92 million years ago, has features found in some wasps, but not found in modern ants. The oldest fossils of ants date to the mid-Cretaceous, around 113–100 million years ago, which belong to extinct stem-groups such as the Haidomyrmecinae, Sphecomyrminae and Zigrasimeciinae, with modern ant subfamilies appearing towards the end of the Cretaceous around 80–70 million years ago. Ants diversified extensively during the Angiosperm Terrestrial Revolution and assumed ecological dominance around 60 million years ago. Some groups, such as the Leptanillinae and Martialinae, are suggested to have diversified from early primitive ants that were likely to have been predators underneath the surface of the soil. During the Cretaceous period, a few species of primitive ants ranged widely on the Laurasian supercontinent (the Northern Hemisphere). Their representation in the fossil record is poor, in comparison to the populations of other insects, representing only about 1% of fossil evidence of insects in the era. Ants became dominant after adaptive radiation at the beginning of the Paleogene period. By the Oligocene and Miocene, ants had come to represent 20–40% of all insects found in major fossil deposits. Of the species that lived in the Eocene epoch, around one in 10 genera survive to the present.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
No. Cardarine is a PPARδ agonist, while selective androgen receptor modulators act on androgen receptors. The two classes differ in receptor target and downstream effects.
Preclinical rodent studies reported cancers, including liver and bladder tumors, at tested doses. The human relevance of those findings is uncertain, but development was discontinued. No approved human product resulted.
No. It remains an investigational compound without approved therapeutic labeling. Sports regulators prohibit its use, and health agencies have warned against consuming it.
It binds and activates PPARδ, a nuclear receptor that influences gene expression related to fatty acid metabolism and energy balance. This mechanism has been studied mainly in animals and cell models, not established as a safe human therapy.